PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G313900.1.p
Common NameSb04g034580, SORBIDRAFT_04g034580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 708aa    MW: 77070 Da    PI: 6.5859
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G313900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-201873156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Sobic.004G313900.1.p 18 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 73
                          678899***********************************************998 PP

2START153.81.4e-482144422206
                           HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
                 START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla 77 
                           +a +a++el+++a+a+e +Wvk +       e +n d++ ++f++ ++       ++e +r+sg+v+m +  lv  ++d++ +++e ++
  Sobic.004G313900.1.p 214 MATRAMDELIRMAQAGEHLWVKTAgggpdgrEVLNVDTYDSIFAKPGGsfrgpdVHVEGSRDSGLVFMSAIGLVDMFMDSS-KFTEFFP 301
                           5789*********************888888888888888888776669********************************.9999999 PP

                           ....EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEE CS
                 START  78 ....kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgilie 155
                               ka t++v+ +g       l+lm+ el ++sp+vp R+f f+Ry+rq + g w+i+d+Svd +q      ++  R+ +lpSg+li 
  Sobic.004G313900.1.p 302 aivsKARTMDVLVNGmagrsDSLVLMYEELHMMSPVVPtREFCFLRYCRQIEHGLWAIADISVDLQQRDARfGAPPSRSCRLPSGCLIA 390
                           9999****************9***********************************************999999999************ PP

                           EECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 156 pksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           ++++g skvtwveh++ ++r+p h l+r l+ sg+a+ga +w+a+lqr ce+
  Sobic.004G313900.1.p 391 DMADGSSKVTWVEHMEIEDRVPiHLLYRDLILSGAAFGAHRWLAALQRACER 442
                           **************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.46E-20775IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-221381IPR009057Homeodomain-like
PROSITE profilePS5007118.0581575IPR001356Homeobox domain
SMARTSM003891.4E-191679IPR001356Homeobox domain
CDDcd000861.25E-191776No hitNo description
PfamPF000463.1E-181873IPR001356Homeobox domain
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084842.76204445IPR002913START domain
SuperFamilySSF559612.28E-30205443No hitNo description
CDDcd088755.67E-106208441No hitNo description
SMARTSM002342.4E-35213442IPR002913START domain
PfamPF018521.2E-39214442IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-5326412IPR023393START-like domain
SuperFamilySSF559618.46E-21462699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MDFGDDVMDG GSDAQRRKKR YHRHTPRQIQ QLEAMFKECP HPDENQRMQL SRELGLEPRQ  60
IKFWFQNRRT QMKAQHERQD NCFLRAENDK IRCENIAMRE ALRTVICHTC GGPPVTDDYF  120
DEQKLRMENA RLKEELDRVS SLTSKYLGRP ITQLPPVQPL SMSSSLDLSV GGLGSPALGP  180
SLDLDLLSGG SSGYPPFHLP MTVSEMERPM MAEMATRAMD ELIRMAQAGE HLWVKTAGGG  240
PDGREVLNVD TYDSIFAKPG GSFRGPDVHV EGSRDSGLVF MSAIGLVDMF MDSSKFTEFF  300
PAIVSKARTM DVLVNGMAGR SDSLVLMYEE LHMMSPVVPT REFCFLRYCR QIEHGLWAIA  360
DISVDLQQRD ARFGAPPSRS CRLPSGCLIA DMADGSSKVT WVEHMEIEDR VPIHLLYRDL  420
ILSGAAFGAH RWLAALQRAC ERCACLATAG MPHRDIAAAG VTPEGKRSMM KLSQRMVSSF  480
CASLSASQLH RWTTLSGPND VGVRVMVHRS TDPGQPSGVV LSAATSIWLP VPCDRVFAFV  540
RDEHTRSQWD VLSHGNPVQE VSRIPNGSHP GNCISLLRGL NASQNSMLIL QESCTDASGS  600
LVVYAPIDIP AANVVMSGED PSAIPLLPSG FTILPDGRPG ASSSSSSAAG GTLGATAAAG  660
SLVTVAFQIL VSSLPSSKLN AESVATVNSL ISTTVEQIKA ALNCASH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452898.10.0hypothetical protein SORBIDRAFT_04g034580
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLC5XTH90.0C5XTH9_SORBI; Putative uncharacterized protein Sb04g034580
STRINGSb04g034580.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11